PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00041.18
Common NameAMTR_s00041p00044170, LOC18441516
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family LBD
Protein Properties Length: 218aa    MW: 22780.8 Da    PI: 8.3868
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00041.18genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.71.2e-40151151100
                                   DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeq.pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAeara 69 
                                              +C aCk+lrrkC+++Cv+apyf +eq +++fa+vhk+FGasnv+kll ++p ++r da+ +++yeA+ar+
  evm_27.model.AmTr_v1.0_scaffold00041.18  15 PCGACKFLRRKCVSGCVFAPYFDSEQgAAHFAAVHKVFGASNVSKLLLHIPAHKRLDAVVTVCYEAQARL 84 
                                              7***********************9989****************************************** PP

                                   DUF260  70 rdPvyGavgvilklqqqleqlkaelallkee 100
                                              rdPvyG+v++i++lqqq+++l+aela+++++
  evm_27.model.AmTr_v1.0_scaffold00041.18  85 RDPVYGCVAHIFALQQQVMNLQAELAYMQAH 115
                                              **************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.99914116IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-3915113IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010311Biological Processlateral root formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MSSGGGGGGG GGNGPCGACK FLRRKCVSGC VFAPYFDSEQ GAAHFAAVHK VFGASNVSKL  60
LLHIPAHKRL DAVVTVCYEA QARLRDPVYG CVAHIFALQQ QVMNLQAELA YMQAHLSTME  120
LPPPPPPPPA PSQPSAAFMS TSPDLIASSS NSNFDLSALF DHHSHYVIDP ASRFYRSQPD  180
PAVTAGGAAG GELHALAREL LTRRRSSPGP STKALSN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00314DAPTransfer from AT2G45420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006851815.11e-158PREDICTED: LOB domain-containing protein 18
SwissprotO221311e-66LBD18_ARATH; LOB domain-containing protein 18
TrEMBLW1PTE31e-158W1PTE3_AMBTC; Uncharacterized protein
STRINGGSMUA_Achr5P11330_0014e-77(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP40515100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45420.13e-64LOB domain-containing protein 18
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]